Lineage for d4f62b1 (4f62 B:1-290)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2010946Species Marinomonas sp. [TaxId:314277] [226403] (1 PDB entry)
  8. 2010948Domain d4f62b1: 4f62 B:1-290 [221039]
    Other proteins in same PDB: d4f62a2, d4f62b2
    automated match to d3p8ra_
    complexed with cl, gol, so4

Details for d4f62b1

PDB Entry: 4f62 (more details), 2.1 Å

PDB Description: crystal structure of a putative farnesyl-diphosphate synthase from marinomonas sp. med121 (target efi-501980)
PDB Compounds: (B:) Geranyltranstransferase

SCOPe Domain Sequences for d4f62b1:

Sequence, based on SEQRES records: (download)

>d4f62b1 a.128.1.0 (B:1-290) automated matches {Marinomonas sp. [TaxId: 314277]}
mnlkqfstytqsrvdqyleqqlsdyapanqlhnamryslfnggkrirpmltyasaqlvgd
issltdasaaalesihayslihddlpamdndelrrgkptchiqfdeatailagdalqtfa
fellsnptsaqpelaikliqelvvasgrngmitgqmidlssenknislaeleqmhvhktg
alikasvrmgalstgqvkpeqlakldayahaiglafqvqddiidltsdtetlgktqfsda
eankatypkllgldgakalvvrlheqaiaqisefgdksqpltdlanyiid

Sequence, based on observed residues (ATOM records): (download)

>d4f62b1 a.128.1.0 (B:1-290) automated matches {Marinomonas sp. [TaxId: 314277]}
mnlkqfstytqsrvdqyleqqlsdyapanqlhnamryslfggkrirpmltyasaqlvgdi
ssltdasaaalesihayslihddlpamfdeatailagdalqtfafellsnptsaqpelai
kliqelvvasgrngmitgqmidlssenislaeleqmhvhktgalikasvrmgalstgqvk
peqlakldayahaiglafqvqddiidlkatypkllgldgakalvvrlheqaiaqisefgd
ksqpltdlanyiid

SCOPe Domain Coordinates for d4f62b1:

Click to download the PDB-style file with coordinates for d4f62b1.
(The format of our PDB-style files is described here.)

Timeline for d4f62b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f62b2