Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d4f58n1: 4f58 N:1-108 [221032] Other proteins in same PDB: d4f58l2, d4f58m2, d4f58n2, d4f58o2 automated match to d1q1jl1 complexed with so4 |
PDB Entry: 4f58 (more details), 2.49 Å
SCOPe Domain Sequences for d4f58n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f58n1 b.1.1.0 (N:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]} qsaltqpasvsgspgqsitisctgttsdvgtynfvswyqqhpgkapkaiifdvtnrpsgi snrfsgskfgntasltisglqaedeadyycaaytvastllfgggtkvtvlrq
Timeline for d4f58n1: