SCOPe 2.06: Domain d4f57l2: 4f57 L:109-209

Lineage for d4f57l2 (4f57 L:109-209)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d4f57l2: 4f57 L:109-209 [221027]
   Other proteins in same PDB: d4f57l1
   automated match to d1q1jl2
   complexed with gol

Details for d4f57l2

PDB Entry: 4f57, 1.7 Å

PDB Description: Fab structure of a neutralizing antibody L1 from an early subtype A HIV-1 infected patient

PDB Compounds: (L:) Light chain of Fab of a neutralizing antibody L1

SCOPe Domain Sequences for d4f57l2:

Sequence; same for both SEQRES and ATOM records:

>d4f57l2 b.1.1.2 (L:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d4f57l2:

• d4f57l2 first appeared in SCOPe 2.03
  
• d4f57l2 appears in SCOPe 2.05
  
• d4f57l2 appears in SCOPe 2.07
  
• d4f57l2 appears in the current release, SCOPe 2.08