Lineage for d4f4ib_ (4f4i B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872866Species Staphylococcus aureus [TaxId:158878] [226321] (5 PDB entries)
  8. 2872873Domain d4f4ib_: 4f4i B: [221025]
    automated match to d2ccja_

Details for d4f4ib_

PDB Entry: 4f4i (more details), 2.45 Å

PDB Description: crystal structure of thymidylate kinase from staphylococcus aureus in apo-form
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4f4ib_:

Sequence, based on SEQRES records: (download)

>d4f4ib_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikylek

Sequence, based on observed residues (ATOM records): (download)

>d4f4ib_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsdqedlkfhekviegyqeiihnesqrfksvnadqpl
envvedtyqtiikylek

SCOPe Domain Coordinates for d4f4ib_:

Click to download the PDB-style file with coordinates for d4f4ib_.
(The format of our PDB-style files is described here.)

Timeline for d4f4ib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4f4ia_