SCOPe 2.08: Domain d4f4ib_: 4f4i B:

Lineage for d4f4ib_ (4f4i B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [226321] (5 PDB entries)

8. Domain d4f4ib_: 4f4i B: [221025]
   automated match to d2ccja_

Details for d4f4ib_

PDB Entry: 4f4i, 2.45 Å

PDB Description: crystal structure of thymidylate kinase from staphylococcus aureus in apo-form

PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4f4ib_:

Sequence, based on SEQRES records:

>d4f4ib_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikylek

Sequence, based on observed residues (ATOM records):

>d4f4ib_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsdqedlkfhekviegyqeiihnesqrfksvnadqpl
envvedtyqtiikylek

Timeline for d4f4ib_:

• d4f4ib_ first appeared in SCOPe 2.03
  
• d4f4ib_ appears in SCOPe 2.07