Lineage for d1bglc2 (1bgl C:626-730)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54910Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 54911Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 54912Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 54913Species Escherichia coli [TaxId:562] [49306] (7 PDB entries)
  8. 54927Domain d1bglc2: 1bgl C:626-730 [22102]
    Other proteins in same PDB: d1bgla3, d1bgla4, d1bgla5, d1bglb3, d1bglb4, d1bglb5, d1bglc3, d1bglc4, d1bglc5, d1bgld3, d1bgld4, d1bgld5, d1bgle3, d1bgle4, d1bgle5, d1bglf3, d1bglf4, d1bglf5, d1bglg3, d1bglg4, d1bglg5, d1bglh3, d1bglh4, d1bglh5

Details for d1bglc2

PDB Entry: 1bgl (more details), 2.5 Å

PDB Description: beta-galactosidase (chains a-h)

SCOP Domain Sequences for d1bglc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bglc2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1bglc2:

Click to download the PDB-style file with coordinates for d1bglc2.
(The format of our PDB-style files is described here.)

Timeline for d1bglc2: