Lineage for d4f3xd_ (4f3x D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909855Species Sinorhizobium meliloti [TaxId:266834] [226320] (9 PDB entries)
  8. 2909859Domain d4f3xd_: 4f3x D: [221017]
    Other proteins in same PDB: d4f3xa2, d4f3xb2, d4f3xc2
    automated match to d1bxsa_
    complexed with gol, nad

Details for d4f3xd_

PDB Entry: 4f3x (more details), 2.01 Å

PDB Description: Crystal structure of putative aldehyde dehydrogenase from Sinorhizobium meliloti 1021 complexed with NAD
PDB Compounds: (D:) Putative aldehyde dehydrogenase

SCOPe Domain Sequences for d4f3xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f3xd_ c.82.1.0 (D:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqttp
aersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlha
paageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtplt
alklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaaktv
krthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvadl
tsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegfff
qptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskamr
aasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminhg

SCOPe Domain Coordinates for d4f3xd_:

Click to download the PDB-style file with coordinates for d4f3xd_.
(The format of our PDB-style files is described here.)

Timeline for d4f3xd_: