SCOPe 2.06: Domain d4f3xc1: 4f3x C:1-475

Lineage for d4f3xc1 (4f3x C:1-475)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (49 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [226320] (9 PDB entries)

8. Domain d4f3xc1: 4f3x C:1-475 [221016]
   Other proteins in same PDB: d4f3xa2, d4f3xb2, d4f3xc2
   automated match to d1bxsa_
   complexed with gol, nad

Details for d4f3xc1

PDB Entry: 4f3x, 2.01 Å

PDB Description: Crystal structure of putative aldehyde dehydrogenase from Sinorhizobium meliloti 1021 complexed with NAD

PDB Compounds: (C:) Putative aldehyde dehydrogenase

SCOPe Domain Sequences for d4f3xc1:

Sequence; same for both SEQRES and ATOM records:

>d4f3xc1 c.82.1.0 (C:1-475) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqttp
aersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlha
paageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtplt
alklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaaktv
krthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvadl
tsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegfff
qptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskamr
aasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminhg

Timeline for d4f3xc1:

• d4f3xc1 first appeared in SCOPe 2.03, called d4f3xc_
  
• d4f3xc1 was called d4f3xc_ in SCOPe 2.05
  
• d4f3xc1 appears in SCOPe 2.07
  
• d4f3xc1 appears in the current release, SCOPe 2.08