| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (140 species) not a true protein |
| Species Burkholderia pseudomallei [TaxId:320372] [226389] (1 PDB entry) |
| Domain d4f3pa1: 4f3p A:26-247 [221012] Other proteins in same PDB: d4f3pa2, d4f3pb2 automated match to d3h7ma_ |
PDB Entry: 4f3p (more details), 2.4 Å
SCOPe Domain Sequences for d4f3pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f3pa1 c.94.1.0 (A:26-247) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
kelvvgtdtsfmpfefkqgdkyvgfdldlwaeiakgagwtykiqpmdfaglipalqtqni
dvalsgmtikeerrkaidfsdpyydsglaamvqannttiksiddlngkviaaktgtatid
wikahlkpkeirqfpnidqaylaleagrvdaamhdtpnvlffvnnegkgrvkvagapvsg
dkygigfpkgsplvakvnaelarmkadgryakiykkwfgsep
Timeline for d4f3pa1: