| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
| Protein automated matches [190142] (21 species) not a true protein |
| Species Salmonella enterica [TaxId:904139] [196952] (5 PDB entries) |
| Domain d4f3ka_: 4f3k A: [221010] automated match to d4f1wa_ complexed with edo, hce |
PDB Entry: 4f3k (more details), 1.85 Å
SCOPe Domain Sequences for d4f3ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f3ka_ c.56.2.1 (A:) automated matches {Salmonella enterica [TaxId: 904139]}
mkigiigameeevtllrdkidnrqtitlggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglastlkvgdivvsdetryhdadvtafgyeygqlpgcpagfk
addkliaaaescirelnlnavrglivsgdafingsvglakirhnfpdavavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqstlmvetlvqkla
Timeline for d4f3ka_: