| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
| Domain d4f37k1: 4f37 K:1-112 [221002] Other proteins in same PDB: d4f37k2, d4f37l2 automated match to d1blna1 |
PDB Entry: 4f37 (more details), 2.57 Å
SCOPe Domain Sequences for d4f37k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f37k1 b.1.1.1 (K:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqtplslpvslgdqasiscrssqtilhsngntylewylqkpgqspnlliykvskrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgsrvpltfgagtklelk
Timeline for d4f37k1:
View in 3DDomains from other chains: (mouse over for more information) d4f37f_, d4f37h_, d4f37l1, d4f37l2 |