Lineage for d4f37k1 (4f37 K:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745157Domain d4f37k1: 4f37 K:1-112 [221002]
    Other proteins in same PDB: d4f37k2, d4f37l2
    automated match to d1blna1

Details for d4f37k1

PDB Entry: 4f37 (more details), 2.57 Å

PDB Description: Structure of the tethered N-terminus of Alzheimer's disease A peptide
PDB Compounds: (K:) Fab WO2 anti-amyloid-beta antibody Fab fragment

SCOPe Domain Sequences for d4f37k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f37k1 b.1.1.1 (K:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqtplslpvslgdqasiscrssqtilhsngntylewylqkpgqspnlliykvskrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgsrvpltfgagtklelk

SCOPe Domain Coordinates for d4f37k1:

Click to download the PDB-style file with coordinates for d4f37k1.
(The format of our PDB-style files is described here.)

Timeline for d4f37k1: