Lineage for d4f33g2 (4f33 G:107-212)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294272Species Escherichia coli [TaxId:562] [224854] (11 PDB entries)
  8. 1294279Domain d4f33g2: 4f33 G:107-212 [221001]
    Other proteins in same PDB: d4f33a1, d4f33c1, d4f33e1, d4f33g1
    automated match to d1dn0a2
    complexed with pg4

Details for d4f33g2

PDB Entry: 4f33 (more details), 1.75 Å

PDB Description: crystal structure of therapeutic antibody morab-009
PDB Compounds: (G:) MORAb-009 Fab light chain

SCOPe Domain Sequences for d4f33g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f33g2 b.1.1.2 (G:107-212) automated matches {Escherichia coli [TaxId: 562]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d4f33g2:

Click to download the PDB-style file with coordinates for d4f33g2.
(The format of our PDB-style files is described here.)

Timeline for d4f33g2: