SCOPe 2.03: Domain d4f33g2: 4f33 G:107-212

Lineage for d4f33g2 (4f33 G:107-212)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (12 species)
not a true protein
Species Escherichia coli [TaxId:562] [224854] (11 PDB entries)
Domain d4f33g2: 4f33 G:107-212 [221001]
Other proteins in same PDB: d4f33a1, d4f33c1, d4f33e1, d4f33g1
automated match to d1dn0a2
complexed with pg4

Details for d4f33g2

PDB Entry: 4f33 (more details), 1.75 Å

PDB Description: crystal structure of therapeutic antibody morab-009

PDB Compounds: (G:) MORAb-009 Fab light chain

SCOPe Domain Sequences for d4f33g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f33g2 b.1.1.2 (G:107-212) automated matches {Escherichia coli [TaxId: 562]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d4f33g2:

Click to download the PDB-style file with coordinates for d4f33g2.
(The format of our PDB-style files is described here.)

Timeline for d4f33g2: