SCOPe 2.04: Domain d4f33e1: 4f33 E:2-106

Lineage for d4f33e1 (4f33 E:2-106)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d4f33e1: 4f33 E:2-106 [220998]
   Other proteins in same PDB: d4f33a2, d4f33c2, d4f33e2, d4f33g2
   automated match to d1dn0a1
   complexed with pg4

Details for d4f33e1

PDB Entry: 4f33, 1.75 Å

PDB Description: crystal structure of therapeutic antibody morab-009

PDB Compounds: (E:) MORAb-009 Fab light chain

SCOPe Domain Sequences for d4f33e1:

Sequence; same for both SEQRES and ATOM records:

>d4f33e1 b.1.1.0 (E:2-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr
fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkvei

Timeline for d4f33e1:

• d4f33e1 first appeared in SCOPe 2.03
  
• d4f33e1 appears in SCOPe 2.05
  
• d4f33e1 appears in the current release, SCOPe 2.08