Lineage for d4f33e1 (4f33 E:2-106)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295867Species Escherichia coli [TaxId:562] [224856] (13 PDB entries)
  8. 1295873Domain d4f33e1: 4f33 E:2-106 [220998]
    Other proteins in same PDB: d4f33a2, d4f33c2, d4f33e2, d4f33g2
    automated match to d1dn0a1
    complexed with pg4

Details for d4f33e1

PDB Entry: 4f33 (more details), 1.75 Å

PDB Description: crystal structure of therapeutic antibody morab-009
PDB Compounds: (E:) MORAb-009 Fab light chain

SCOPe Domain Sequences for d4f33e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f33e1 b.1.1.0 (E:2-106) automated matches {Escherichia coli [TaxId: 562]}
dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr
fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkvei

SCOPe Domain Coordinates for d4f33e1:

Click to download the PDB-style file with coordinates for d4f33e1.
(The format of our PDB-style files is described here.)

Timeline for d4f33e1: