| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (9 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries) |
| Domain d4f33c2: 4f33 C:107-212 [220997] Other proteins in same PDB: d4f33a1, d4f33c1, d4f33e1, d4f33g1 automated match to d1dn0a2 complexed with pg4 |
PDB Entry: 4f33 (more details), 1.75 Å
SCOPe Domain Sequences for d4f33c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f33c2 b.1.1.2 (C:107-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d4f33c2: