SCOPe 2.04: Domain d4f32b2: 4f32 B:262-422

Lineage for d4f32b2 (4f32 B:262-422)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (45 species)
   not a true protein

7. Species Burkholderia vietnamiensis [TaxId:269482] [226385] (2 PDB entries)

8. Domain d4f32b2: 4f32 B:262-422 [220993]
   automated match to d1j3na2
   complexed with edo, n32

Details for d4f32b2

PDB Entry: 4f32, 1.9 Å

PDB Description: Crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase II from Burkholderia vietnamiensis in complex with platencin

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4f32b2:

Sequence; same for both SEQRES and ATOM records:

>d4f32b2 c.95.1.0 (B:262-422) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
rpiaeiigygttadayhmtagpddgsgamramklalrmgdvapeqvdyvnahatstpvgd
ageiealktvfgvgagpaisstksatghllgaagaieaafsilalrdgvlpgtlnlehpd
paadgldligpaarhvpveialsngfgfggvnasvlfrryp

Timeline for d4f32b2:

• d4f32b2 first appeared in SCOPe 2.03
  
• d4f32b2 appears in SCOPe 2.05
  
• d4f32b2 appears in the current release, SCOPe 2.08