![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Burkholderia vietnamiensis [TaxId:269482] [226385] (2 PDB entries) |
![]() | Domain d4f32a1: 4f32 A:3-261 [220990] Other proteins in same PDB: d4f32b3 automated match to d1j3na1 complexed with edo, n32 |
PDB Entry: 4f32 (more details), 1.9 Å
SCOPe Domain Sequences for d4f32a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f32a1 c.95.1.0 (A:3-261) automated matches {Burkholderia vietnamiensis [TaxId: 269482]} lrvvvtgigivsplgcgkelvwqrligggsglrrlgddiagelsakvggtvqdvaedpeg gfdpersvphkelrkmdrfiqmamvaadealaeagwapeaeqqrertatvvasgiggfpg laeavrigetrgvrrlspftipfflsnlaagqisikhrfrgplgcpvtacaasvqaigda mrmirtgeadvvlaggaeaafdkvslggfaaaralstgfseepvrasrpfdrdrdgfvmg egaamvvvesldhalarga
Timeline for d4f32a1: