Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein automated matches [190142] (18 species) not a true protein |
Species Salmonella enterica [TaxId:904139] [196952] (5 PDB entries) |
Domain d4f2pb_: 4f2p B: [220989] automated match to d4f2wb_ complexed with 2el, act, edo, gol |
PDB Entry: 4f2p (more details), 1.64 Å
SCOPe Domain Sequences for d4f2pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f2pb_ c.56.2.1 (B:) automated matches {Salmonella enterica [TaxId: 904139]} lvprgshmkigiigameeevtllrdkidnrqtitlggceiytgqlngtevallksgigkv aaalgatlllehckpdviintgsagglastlkvgdivvsdetryhdadvtafgyeygqlp gcpagfkaddkliaaaescirelnlnavrglivsgdafingsvglakirhnfpdavavem eataiahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqstlmvetlvqklahg
Timeline for d4f2pb_: