SCOPe 2.03: Domain d4f2pb_: 4f2p B:

Lineage for d4f2pb_ (4f2p B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein automated matches [190142] (16 species)
   not a true protein

7. Species Salmonella enterica [TaxId:904139] [196952] (5 PDB entries)

8. Domain d4f2pb_: 4f2p B: [220989]
   automated match to d4f2wb_
   complexed with 2el, act, edo, gol

Details for d4f2pb_

PDB Entry: 4f2p, 1.64 Å

PDB Description: Crystal structure of 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Salmonella enterica with diEtglycol-thio-DADMe-Immucillin-A

PDB Compounds: (B:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4f2pb_:

Sequence; same for both SEQRES and ATOM records:

>d4f2pb_ c.56.2.1 (B:) automated matches {Salmonella enterica [TaxId: 904139]}
lvprgshmkigiigameeevtllrdkidnrqtitlggceiytgqlngtevallksgigkv
aaalgatlllehckpdviintgsagglastlkvgdivvsdetryhdadvtafgyeygqlp
gcpagfkaddkliaaaescirelnlnavrglivsgdafingsvglakirhnfpdavavem
eataiahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqstlmvetlvqklahg

Timeline for d4f2pb_:

• d4f2pb_ is new in SCOPe 2.03-stable
  
• d4f2pb_ appears in SCOPe 2.04
  
• d4f2pb_ appears in the current release, SCOPe 2.08, called d4f2pb1