Lineage for d4f2pb1 (4f2p B:1-232)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888641Protein automated matches [190142] (21 species)
    not a true protein
  7. 2888752Species Salmonella enterica [TaxId:904139] [196952] (5 PDB entries)
  8. 2888756Domain d4f2pb1: 4f2p B:1-232 [220989]
    Other proteins in same PDB: d4f2pb2
    automated match to d4f2wb_
    complexed with 2el, act, edo, gol

Details for d4f2pb1

PDB Entry: 4f2p (more details), 1.64 Å

PDB Description: Crystal structure of 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Salmonella enterica with diEtglycol-thio-DADMe-Immucillin-A
PDB Compounds: (B:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4f2pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f2pb1 c.56.2.1 (B:1-232) automated matches {Salmonella enterica [TaxId: 904139]}
mkigiigameeevtllrdkidnrqtitlggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglastlkvgdivvsdetryhdadvtafgyeygqlpgcpagfk
addkliaaaescirelnlnavrglivsgdafingsvglakirhnfpdavavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqstlmvetlvqklahg

SCOPe Domain Coordinates for d4f2pb1:

Click to download the PDB-style file with coordinates for d4f2pb1.
(The format of our PDB-style files is described here.)

Timeline for d4f2pb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f2pb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4f2pa_