Lineage for d4f2pa_ (4f2p A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1375163Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1375179Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1375180Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1375817Protein automated matches [190142] (16 species)
    not a true protein
  7. 1375871Species Salmonella enterica [TaxId:904139] [196952] (5 PDB entries)
  8. 1375874Domain d4f2pa_: 4f2p A: [220988]
    automated match to d4f1wa_
    complexed with 2el, act, edo, gol

Details for d4f2pa_

PDB Entry: 4f2p (more details), 1.64 Å

PDB Description: Crystal structure of 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Salmonella enterica with diEtglycol-thio-DADMe-Immucillin-A
PDB Compounds: (A:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4f2pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f2pa_ c.56.2.1 (A:) automated matches {Salmonella enterica [TaxId: 904139]}
mkigiigameeevtllrdkidnrqtitlggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglastlkvgdivvsdetryhdadvtafgyeygqlpgcpagfk
addkliaaaescirelnlnavrglivsgdafingsvglakirhnfpdavavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqstlmvetlvqklah

SCOPe Domain Coordinates for d4f2pa_:

Click to download the PDB-style file with coordinates for d4f2pa_.
(The format of our PDB-style files is described here.)

Timeline for d4f2pa_: