| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
| Protein automated matches [226859] (39 species) not a true protein |
| Species Leishmania major [TaxId:5664] [226380] (1 PDB entry) |
| Domain d4f2nl1: 4f2n L:22-117 [220985] Other proteins in same PDB: d4f2na2, d4f2nb2, d4f2nc2, d4f2nd2, d4f2ne2, d4f2nf2, d4f2ng2, d4f2nh2, d4f2ni2, d4f2nj2, d4f2nk2, d4f2nl2 automated match to d1mnga1 complexed with fe2 |
PDB Entry: 4f2n (more details), 1.85 Å
SCOPe Domain Sequences for d4f2nl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f2nl1 a.2.11.0 (L:22-117) automated matches {Leishmania major [TaxId: 5664]}
cyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegkt
ieeiilattgineskvmfnqaaqhfnhsffwkclsp
Timeline for d4f2nl1: