Lineage for d4f2ni2 (4f2n I:118-230)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2553188Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2553189Protein automated matches [226860] (37 species)
    not a true protein
  7. 2553329Species Leishmania major [TaxId:5664] [226381] (1 PDB entry)
  8. 2553338Domain d4f2ni2: 4f2n I:118-230 [220980]
    Other proteins in same PDB: d4f2na1, d4f2nb1, d4f2nc1, d4f2nd1, d4f2ne1, d4f2nf1, d4f2ng1, d4f2nh1, d4f2ni1, d4f2nj1, d4f2nk1, d4f2nl1
    automated match to d1mnga2
    complexed with fe2

Details for d4f2ni2

PDB Entry: 4f2n (more details), 1.85 Å

PDB Description: crystal structure of iron superoxide dismutase from leishmania major
PDB Compounds: (I:) superoxide dismutase

SCOPe Domain Sequences for d4f2ni2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f2ni2 d.44.1.0 (I:118-230) automated matches {Leishmania major [TaxId: 5664]}
ggkpmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnag
cpltsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk

SCOPe Domain Coordinates for d4f2ni2:

Click to download the PDB-style file with coordinates for d4f2ni2.
(The format of our PDB-style files is described here.)

Timeline for d4f2ni2: