SCOPe 2.08: Domain d4f2ne1: 4f2n E:22-117

Lineage for d4f2ne1 (4f2n E:22-117)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [226380] (1 PDB entry)

8. Domain d4f2ne1: 4f2n E:22-117 [220971]
   Other proteins in same PDB: d4f2na2, d4f2nb2, d4f2nc2, d4f2nd2, d4f2ne2, d4f2nf2, d4f2ng2, d4f2nh2, d4f2ni2, d4f2nj2, d4f2nk2, d4f2nl2
   automated match to d1mnga1
   complexed with fe2

Details for d4f2ne1

PDB Entry: 4f2n, 1.85 Å

PDB Description: crystal structure of iron superoxide dismutase from leishmania major

PDB Compounds: (E:) superoxide dismutase

SCOPe Domain Sequences for d4f2ne1:

Sequence; same for both SEQRES and ATOM records:

>d4f2ne1 a.2.11.0 (E:22-117) automated matches {Leishmania major [TaxId: 5664]}
cyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegkt
ieeiilattgineskvmfnqaaqhfnhsffwkclsp

Timeline for d4f2ne1:

• d4f2ne1 first appeared in SCOPe 2.03
  
• d4f2ne1 appears in SCOPe 2.07