Lineage for d4f2nd1 (4f2n D:21-117)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690487Species Leishmania major [TaxId:5664] [226380] (1 PDB entry)
  8. 2690491Domain d4f2nd1: 4f2n D:21-117 [220969]
    Other proteins in same PDB: d4f2na2, d4f2nb2, d4f2nc2, d4f2nd2, d4f2ne2, d4f2nf2, d4f2ng2, d4f2nh2, d4f2ni2, d4f2nj2, d4f2nk2, d4f2nl2
    automated match to d1mnga1
    complexed with fe2

Details for d4f2nd1

PDB Entry: 4f2n (more details), 1.85 Å

PDB Description: crystal structure of iron superoxide dismutase from leishmania major
PDB Compounds: (D:) superoxide dismutase

SCOPe Domain Sequences for d4f2nd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f2nd1 a.2.11.0 (D:21-117) automated matches {Leishmania major [TaxId: 5664]}
lcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegk
tieeiilattgineskvmfnqaaqhfnhsffwkclsp

SCOPe Domain Coordinates for d4f2nd1:

Click to download the PDB-style file with coordinates for d4f2nd1.
(The format of our PDB-style files is described here.)

Timeline for d4f2nd1: