Lineage for d4f2na1 (4f2n A:22-117)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476004Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1476277Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1476544Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1476545Protein automated matches [226859] (26 species)
    not a true protein
  7. 1476612Species Leishmania major [TaxId:5664] [226380] (1 PDB entry)
  8. 1476613Domain d4f2na1: 4f2n A:22-117 [220963]
    Other proteins in same PDB: d4f2na2, d4f2nb2, d4f2nc2, d4f2nd2, d4f2ne2, d4f2nf2, d4f2ng2, d4f2nh2, d4f2ni2, d4f2nj2, d4f2nk2, d4f2nl2
    automated match to d1mnga1
    complexed with fe2

Details for d4f2na1

PDB Entry: 4f2n (more details), 1.85 Å

PDB Description: crystal structure of iron superoxide dismutase from leishmania major
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4f2na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f2na1 a.2.11.0 (A:22-117) automated matches {Leishmania major [TaxId: 5664]}
cyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegkt
ieeiilattgineskvmfnqaaqhfnhsffwkclsp

SCOPe Domain Coordinates for d4f2na1:

Click to download the PDB-style file with coordinates for d4f2na1.
(The format of our PDB-style files is described here.)

Timeline for d4f2na1: