SCOPe 2.03: Domain d4f2db2: 4f2d B:329-498

Lineage for d4f2db2 (4f2d B:329-498)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families)

5. Family b.43.2.0: automated matches [227252] (1 protein)
   not a true family

6. Protein automated matches [227032] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [226394] (1 PDB entry)

8. Domain d4f2db2: 4f2d B:329-498 [220955]
   Other proteins in same PDB: d4f2da1, d4f2db1, d4f2dc1
   automated match to d2ajta1
   complexed with acy, mn, rb0

Details for d4f2db2

PDB Entry: 4f2d, 2.3 Å

PDB Description: crystal structure of escherichia coli l-arabinose isomerase (ecai) complexed with ribitol

PDB Compounds: (B:) L-arabinose isomerase

SCOPe Domain Sequences for d4f2db2:

Sequence; same for both SEQRES and ATOM records:

>d4f2db2 b.43.2.0 (B:329-498) automated matches {Escherichia coli [TaxId: 83333]}
tsfmedytyhfekgndlvlgshmlevcpsiaveekpildvqhlgiggkddparlifntqt
gpaivaslidlgdryrllvncidtvktphslpklpvanalwkaqpdlptaseawilagga
hhtvfshalnlndmrqfaemhdieitvidndtrlpafkdalrwnevyygf

Timeline for d4f2db2:

• d4f2db2 is new in SCOPe 2.03-stable
  
• d4f2db2 appears in SCOPe 2.04
  
• d4f2db2 appears in the current release, SCOPe 2.08