Class b: All beta proteins [48724] (177 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) |
Family b.43.2.0: automated matches [227252] (1 protein) not a true family |
Protein automated matches [227032] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [226394] (1 PDB entry) |
Domain d4f2da2: 4f2d A:329-498 [220953] Other proteins in same PDB: d4f2da1, d4f2db1, d4f2dc1 automated match to d2ajta1 complexed with acy, mn, rb0 |
PDB Entry: 4f2d (more details), 2.3 Å
SCOPe Domain Sequences for d4f2da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f2da2 b.43.2.0 (A:329-498) automated matches {Escherichia coli K-12 [TaxId: 83333]} tsfmedytyhfekgndlvlgshmlevcpsiaveekpildvqhlgiggkddparlifntqt gpaivaslidlgdryrllvncidtvktphslpklpvanalwkaqpdlptaseawilagga hhtvfshalnlndmrqfaemhdieitvidndtrlpafkdalrwnevyygf
Timeline for d4f2da2:
View in 3D Domains from other chains: (mouse over for more information) d4f2db1, d4f2db2, d4f2dc1, d4f2dc2 |