Lineage for d4f2da1 (4f2d A:1-328)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910317Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
    consists of two domains of similar topology, 3 layers (a/b/a) each
    Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
    Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134
  4. 2910318Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) (S)
  5. 2910342Family c.85.1.2: AraA N-terminal and middle domain-like [142760] (2 proteins)
    N-terminal part of Pfam PF02610
  6. 2910351Protein automated matches [227083] (1 species)
    not a true protein
  7. 2910352Species Escherichia coli K-12 [TaxId:83333] [226393] (1 PDB entry)
  8. 2910353Domain d4f2da1: 4f2d A:1-328 [220952]
    Other proteins in same PDB: d4f2da2, d4f2db2, d4f2dc2
    automated match to d2ajta2
    complexed with acy, mn, rb0

Details for d4f2da1

PDB Entry: 4f2d (more details), 2.3 Å

PDB Description: crystal structure of escherichia coli l-arabinose isomerase (ecai) complexed with ribitol
PDB Compounds: (A:) L-arabinose isomerase

SCOPe Domain Sequences for d4f2da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f2da1 c.85.1.2 (A:1-328) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
taicrdanyddrcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
ygfagegdwktaallrimkvmstglqgg

SCOPe Domain Coordinates for d4f2da1:

Click to download the PDB-style file with coordinates for d4f2da1.
(The format of our PDB-style files is described here.)

Timeline for d4f2da1: