Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein automated matches [190140] (37 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries) |
Domain d4f29a_: 4f29 A: [220951] automated match to d3lswa_ complexed with qus, zn |
PDB Entry: 4f29 (more details), 1.75 Å
SCOPe Domain Sequences for d4f29a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f29a_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies aedlakqteiaygtldsgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgtpvnlavlklse qgildklknkwwydkgec
Timeline for d4f29a_: