Lineage for d4f1ra_ (4f1r A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988254Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2988255Protein automated matches [190734] (14 species)
    not a true protein
  7. 2988294Species Pseudomonas aeruginosa [TaxId:287] [226583] (3 PDB entries)
  8. 2988296Domain d4f1ra_: 4f1r A: [220945]
    automated match to d2o3ha_

Details for d4f1ra_

PDB Entry: 4f1r (more details), 2.2 Å

PDB Description: Structure analysis of the global metabolic regulator Crc from Pseudomonas aeruginos
PDB Compounds: (A:) Catabolite repression control protein

SCOPe Domain Sequences for d4f1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f1ra_ d.151.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mriisvnvngiqaaaergllswlqaqnadviclqdtrasafdlddpsfqldgyflyacda
elpeqggvalysrlqpkavisglgfetadrygrylqadfdkvsiatlllpsgqsgdesln
qkfkfmddfthylskqrrkrreyiycgslyvahqkmdvknwrecqqmpgflaperawlde
vfgnlgyadalrevsregdqfswwpdseqaemlnlgwrfdyqvltpglrrfvrnaklprq
prfsqhaplivdydwqlsi

SCOPe Domain Coordinates for d4f1ra_:

Click to download the PDB-style file with coordinates for d4f1ra_.
(The format of our PDB-style files is described here.)

Timeline for d4f1ra_: