Lineage for d4f15l2 (4f15 L:111-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753343Domain d4f15l2: 4f15 L:111-213 [220944]
    Other proteins in same PDB: d4f15b_, d4f15c1, d4f15e_, d4f15f1, d4f15h_, d4f15i1, d4f15k_, d4f15l1
    automated match to d1dqdl2

Details for d4f15l2

PDB Entry: 4f15 (more details), 2.81 Å

PDB Description: molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses
PDB Compounds: (L:) Fab fragment, light chain

SCOPe Domain Sequences for d4f15l2:

Sequence, based on SEQRES records: (download)

>d4f15l2 b.1.1.2 (L:111-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Sequence, based on observed residues (ATOM records): (download)

>d4f15l2 b.1.1.2 (L:111-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsgasvvcflnnfypkinvkwkidgserqngvlnswtdqdsk
dstysmsstltlyerhnsytceathktstspivksfn

SCOPe Domain Coordinates for d4f15l2:

Click to download the PDB-style file with coordinates for d4f15l2.
(The format of our PDB-style files is described here.)

Timeline for d4f15l2: