SCOPe 2.03: Domain d4f15f1: 4f15 F:1-110

Lineage for d4f15f1 (4f15 F:1-110)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d4f15f1: 4f15 F:1-110 [220939]
   Other proteins in same PDB: d4f15c2, d4f15f2, d4f15i2, d4f15l2
   automated match to d1dqdl1

Details for d4f15f1

PDB Entry: 4f15, 2.81 Å

PDB Description: molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses

PDB Compounds: (F:) Fab fragment, light chain

SCOPe Domain Sequences for d4f15f1:

Sequence, based on SEQRES records:

>d4f15f1 b.1.1.0 (F:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqmtqspaslavspgqratitcrasesvsnyginfinwfqqkpgqppklliytasnkgtg
vparfsgsgsgtdftltinpveaedtanyfcqqtkevpygtfggtkleik

Sequence, based on observed residues (ATOM records):

>d4f15f1 b.1.1.0 (F:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqmtqspaslavspgqratitcrasesvsnfinwfqqkpgqppklliytasnkgtgvpar
fsgsgsgtdftltinpveaedtanyfcqqtkevpygtfggtkleik

Timeline for d4f15f1:

• d4f15f1 is new in SCOPe 2.03-stable
  
• d4f15f1 appears in SCOPe 2.04
  
• d4f15f1 appears in the current release, SCOPe 2.08