Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (42 species) not a true protein |
Species Acinetobacter haemolyticus [TaxId:29430] [226372] (2 PDB entries) |
Domain d4f0ya_: 4f0y A: [220935] automated match to d1s5ka_ complexed with cl, gol, mg |
PDB Entry: 4f0y (more details), 2.56 Å
SCOPe Domain Sequences for d4f0ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f0ya_ d.108.1.0 (A:) automated matches {Acinetobacter haemolyticus [TaxId: 29430]} mnikpaseaslkdwlelrnklwsdseashlqemhqllaekyalqllaysdhqaiamleas irfeyvngtetspvgflegiyvlpahrrsgvatmlirqaevwakqfsctefasdaaldnv ishamhrslgfqetekvvyfskkid
Timeline for d4f0ya_: