SCOPe 2.06: Domain d4f0ya_: 4f0y A:

Lineage for d4f0ya_ (4f0y A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Acinetobacter haemolyticus [TaxId:29430] [226372] (2 PDB entries)

8. Domain d4f0ya_: 4f0y A: [220935]
   automated match to d1s5ka_
   complexed with cl, gol, mg

Details for d4f0ya_

PDB Entry: 4f0y, 2.56 Å

PDB Description: crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ig from acinetobacter haemolyticus, apo

PDB Compounds: (A:) Aminoglycoside N(6')-acetyltransferase type 1

SCOPe Domain Sequences for d4f0ya_:

Sequence; same for both SEQRES and ATOM records:

>d4f0ya_ d.108.1.0 (A:) automated matches {Acinetobacter haemolyticus [TaxId: 29430]}
mnikpaseaslkdwlelrnklwsdseashlqemhqllaekyalqllaysdhqaiamleas
irfeyvngtetspvgflegiyvlpahrrsgvatmlirqaevwakqfsctefasdaaldnv
ishamhrslgfqetekvvyfskkid

Timeline for d4f0ya_:

• d4f0ya_ first appeared in SCOPe 2.03
  
• d4f0ya_ appears in SCOPe 2.05
  
• d4f0ya_ appears in SCOPe 2.07
  
• d4f0ya_ appears in the current release, SCOPe 2.08