![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
![]() | Protein automated matches [226983] (27 species) not a true protein |
![]() | Species Red algae (Galdieria sulphuraria) [TaxId:130081] [226524] (3 PDB entries) |
![]() | Domain d4f0ma1: 4f0m A:27-158 [220932] Other proteins in same PDB: d4f0ma2, d4f0mb_ automated match to d1bwva2 complexed with cl, gol, mg |
PDB Entry: 4f0m (more details), 2.25 Å
SCOPe Domain Sequences for d4f0ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f0ma1 d.58.9.0 (A:27-158) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]} pyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstatwtvvwtdlltaa dlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvfgfkavkalrled mrlpfayiktfq
Timeline for d4f0ma1: