Lineage for d4f0ha2 (4f0h A:159-474)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1824891Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 1824892Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 1825087Protein automated matches [226984] (5 species)
    not a true protein
  7. 1825170Species Red algae (Galdieria sulphuraria) [TaxId:130081] [226525] (3 PDB entries)
  8. 1825171Domain d4f0ha2: 4f0h A:159-474 [220928]
    Other proteins in same PDB: d4f0ha1, d4f0hb_
    automated match to d1bwva1
    complexed with oxy, po4

Details for d4f0ha2

PDB Entry: 4f0h (more details), 1.96 Å

PDB Description: unactivated rubisco with oxygen bound
PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d4f0ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f0ha2 c.1.14.1 (A:159-474) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]}
gpatgvilererldkfgrpllgcttkpklglsgknygrvvyealkggldfvkddeninsq
pfmrwrerylfvmeavnkaaaatgevkghylnvtaatmeemyaraqlakelgsviimidl
vigytaiqtmakwardndmilhlhragnstysrqknhgmnfrvickwmrmagvdhihagt
vvgklegdpiitrgfyktlllpklernlqeglffdmdwaslrkvmpvasggihagqmhql
ihylgedvvlqfgggtighpdgiqsgatanrvaleamilarnenrdfltegpeilreaak
ncgalrtaldlwkdit

SCOPe Domain Coordinates for d4f0ha2:

Click to download the PDB-style file with coordinates for d4f0ha2.
(The format of our PDB-style files is described here.)

Timeline for d4f0ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f0ha1
View in 3D
Domains from other chains:
(mouse over for more information)
d4f0hb_