SCOPe 2.08: Domain d4f0ca2: 4f0c A:93-229

Lineage for d4f0ca2 (4f0c A:93-229)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (9 PDB entries)

8. Domain d4f0ca2: 4f0c A:93-229 [220925]
   Other proteins in same PDB: d4f0ca1
   automated match to d1k0db1
   complexed with gds, gol, so4

Details for d4f0ca2

PDB Entry: 4f0c, 1.9 Å

PDB Description: crystal structure of the glutathione transferase ure2p5 from phanerochaete chrysosporium

PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d4f0ca2:

Sequence; same for both SEQRES and ATOM records:

>d4f0ca2 a.45.1.0 (A:93-229) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
vstfddkiimtqwlffqasgqgpyfgqagwflavappeernptiaeryqkeilrvfgvle
svlsqrqwlvadkltiadisfviwnatavnllvkgykgfdfekdfpsvhrwhtalitrpa
iaeslktkaeaiaqmnr

Timeline for d4f0ca2:

• d4f0ca2 first appeared in SCOPe 2.03
  
• d4f0ca2 appears in SCOPe 2.07