Class a: All alpha proteins [46456] (284 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (1 family) |
Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins) |
Protein automated matches [227118] (1 species) not a true protein |
Species Escherichia coli [TaxId:83333] [226639] (2 PDB entries) |
Domain d4f01b2: 4f01 B:507-604 [220914] Other proteins in same PDB: d4f01a1, d4f01b1 automated match to d1dkya1 |
PDB Entry: 4f01 (more details), 1.4 Å
SCOPe Domain Sequences for d4f01b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f01b2 a.8.4.1 (B:507-604) automated matches {Escherichia coli [TaxId: 83333]} lnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaie saltaletalkgedkaaieakmqelaqvsqklmeiaqq
Timeline for d4f01b2: