Lineage for d4f01b2 (4f01 B:507-604)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1261719Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1261863Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (1 family) (S)
  5. 1261864Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)
  6. 1261879Protein automated matches [227118] (1 species)
    not a true protein
  7. 1261880Species Escherichia coli [TaxId:83333] [226639] (2 PDB entries)
  8. 1261882Domain d4f01b2: 4f01 B:507-604 [220914]
    Other proteins in same PDB: d4f01a1, d4f01b1
    automated match to d1dkya1

Details for d4f01b2

PDB Entry: 4f01 (more details), 1.4 Å

PDB Description: crystal structure of an artificial dimeric dnak complex
PDB Compounds: (B:) Chaperone protein dnaK

SCOPe Domain Sequences for d4f01b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f01b2 a.8.4.1 (B:507-604) automated matches {Escherichia coli [TaxId: 83333]}
lnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaie
saltaletalkgedkaaieakmqelaqvsqklmeiaqq

SCOPe Domain Coordinates for d4f01b2:

Click to download the PDB-style file with coordinates for d4f01b2.
(The format of our PDB-style files is described here.)

Timeline for d4f01b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f01b1