SCOPe 2.08: Domain d4f01b2: 4f01 B:507-604

Lineage for d4f01b2 (4f01 B:507-604)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families)

5. Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)

6. Protein automated matches [227118] (3 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226639] (2 PDB entries)

8. Domain d4f01b2: 4f01 B:507-604 [220914]
   Other proteins in same PDB: d4f01a1, d4f01a3, d4f01b1, d4f01b3
   automated match to d1dkya1

Details for d4f01b2

PDB Entry: 4f01, 1.4 Å

PDB Description: crystal structure of an artificial dimeric dnak complex

PDB Compounds: (B:) Chaperone protein dnaK

SCOPe Domain Sequences for d4f01b2:

Sequence; same for both SEQRES and ATOM records:

>d4f01b2 a.8.4.1 (B:507-604) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaie
saltaletalkgedkaaieakmqelaqvsqklmeiaqq

Timeline for d4f01b2:

• d4f01b2 first appeared in SCOPe 2.03
  
• d4f01b2 appears in SCOPe 2.07