Lineage for d4f01b1 (4f01 B:373-506)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1336001Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 1336002Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 1336003Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)
  6. 1336023Protein automated matches [227117] (1 species)
    not a true protein
  7. 1336024Species Escherichia coli [TaxId:83333] [226638] (2 PDB entries)
  8. 1336026Domain d4f01b1: 4f01 B:373-506 [220913]
    Other proteins in same PDB: d4f01a2, d4f01b2
    automated match to d1dkza2

Details for d4f01b1

PDB Entry: 4f01 (more details), 1.4 Å

PDB Description: crystal structure of an artificial dimeric dnak complex
PDB Compounds: (B:) Chaperone protein dnaK

SCOPe Domain Sequences for d4f01b1:

Sequence, based on SEQRES records: (download)

>d4f01b1 b.130.1.1 (B:373-506) automated matches {Escherichia coli [TaxId: 83333]}
hhhhhhssghiegrhmvllldvtplslgietmggvmttliaknttiptkhsqvfstaedn
qsavtihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdkn
sgkeqkitikassg

Sequence, based on observed residues (ATOM records): (download)

>d4f01b1 b.130.1.1 (B:373-506) automated matches {Escherichia coli [TaxId: 83333]}
hhhhhhshiegrhmvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqs
avtihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsg
keqkitikassg

SCOPe Domain Coordinates for d4f01b1:

Click to download the PDB-style file with coordinates for d4f01b1.
(The format of our PDB-style files is described here.)

Timeline for d4f01b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f01b2