Lineage for d4f01a2 (4f01 A:507-602)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697230Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) (S)
  5. 2697231Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)
  6. 2697246Protein automated matches [227118] (3 species)
    not a true protein
  7. 2697247Species Escherichia coli K-12 [TaxId:83333] [226639] (2 PDB entries)
  8. 2697248Domain d4f01a2: 4f01 A:507-602 [220912]
    Other proteins in same PDB: d4f01a1, d4f01a3, d4f01b1, d4f01b3
    automated match to d1dkya1

Details for d4f01a2

PDB Entry: 4f01 (more details), 1.4 Å

PDB Description: crystal structure of an artificial dimeric dnak complex
PDB Compounds: (A:) Chaperone protein dnaK

SCOPe Domain Sequences for d4f01a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f01a2 a.8.4.1 (A:507-602) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaie
saltaletalkgedkaaieakmqelaqvsqklmeia

SCOPe Domain Coordinates for d4f01a2:

Click to download the PDB-style file with coordinates for d4f01a2.
(The format of our PDB-style files is described here.)

Timeline for d4f01a2: