SCOPe 2.08: Domain d4f01a1: 4f01 A:389-506

Lineage for d4f01a1 (4f01 A:389-506)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
   beta-sandwich: 8 strands in 2 sheets

4. Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family)

5. Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)

6. Protein automated matches [227117] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226638] (2 PDB entries)

8. Domain d4f01a1: 4f01 A:389-506 [220911]
   Other proteins in same PDB: d4f01a2, d4f01a3, d4f01b2, d4f01b3
   automated match to d1dkza2

Details for d4f01a1

PDB Entry: 4f01, 1.4 Å

PDB Description: crystal structure of an artificial dimeric dnak complex

PDB Compounds: (A:) Chaperone protein dnaK

SCOPe Domain Sequences for d4f01a1:

Sequence; same for both SEQRES and ATOM records:

>d4f01a1 b.130.1.1 (A:389-506) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkra
adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassg

Timeline for d4f01a1:

• d4f01a1 first appeared in SCOPe 2.03
  
• d4f01a1 appears in SCOPe 2.07