SCOPe 2.07: Domain d4ez8a_: 4ez8 A:

Lineage for d4ez8a_ (4ez8 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries)

8. Domain d4ez8a_: 4ez8 A: [220908]
   automated match to d3ed7a_
   complexed with dhf, gol, noh

Details for d4ez8a_

PDB Entry: 4ez8, 1.17 Å

PDB Description: Crystal structure of mouse thymidylate sythase in ternary complex with N(4)-hydroxy-2'-deoxycytidine-5'-monophosphate and the cofactor product, dihydrofolate

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d4ez8a_:

Sequence; same for both SEQRES and ATOM records:

>d4ez8a_ d.117.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav

Timeline for d4ez8a_:

• d4ez8a_ first appeared in SCOPe 2.03
  
• d4ez8a_ appears in SCOPe 2.06
  
• d4ez8a_ appears in the current release, SCOPe 2.08