Lineage for d4ez8a_ (4ez8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972665Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries)
  8. 2972666Domain d4ez8a_: 4ez8 A: [220908]
    automated match to d3ed7a_
    complexed with dhf, gol, noh

Details for d4ez8a_

PDB Entry: 4ez8 (more details), 1.17 Å

PDB Description: Crystal structure of mouse thymidylate sythase in ternary complex with N(4)-hydroxy-2'-deoxycytidine-5'-monophosphate and the cofactor product, dihydrofolate
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d4ez8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ez8a_ d.117.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav

SCOPe Domain Coordinates for d4ez8a_:

Click to download the PDB-style file with coordinates for d4ez8a_.
(The format of our PDB-style files is described here.)

Timeline for d4ez8a_: