SCOPe 2.05: Domain d4exlc_: 4exl C:

Lineage for d4exlc_ (4exl C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:637987] [193477] (7 PDB entries)

8. Domain d4exlc_: 4exl C: [220902]
   automated match to d4ecfa_
   complexed with cl, mg

Details for d4exlc_

PDB Entry: 4exl, 1.7 Å

PDB Description: Crystal structure of phosphate ABC transporter, periplasmic phosphate-binding protein PstS 1 (PBP1) from Streptococcus pneumoniae Canada MDR_19A

PDB Compounds: (C:) Phosphate-binding protein pstS 1

SCOPe Domain Sequences for d4exlc_:

Sequence; same for both SEQRES and ATOM records:

>d4exlc_ c.94.1.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}
esitavgstalqplvevaadefgtihvgktvnvqgggsgtglsqvqsgavdignsdvfae
ekdgidasalvdhkvavaglalivnkevdvdnltteqlrqifigevtnwkevggkdlpis
vinraagsgsratfdtvimegqsamqsqeqdsngavksivskspgaisylsltyiddsvk
smklngydlspenissnnwplwsyehmytlgqpnelaaeflnfvlsdetqegivkglkyi
pikemkvekdaagtvtvlegrq

Timeline for d4exlc_:

• d4exlc_ first appeared in SCOPe 2.03
  
• d4exlc_ appears in SCOPe 2.04
  
• d4exlc_ appears in SCOPe 2.06
  
• d4exlc_ appears in the current release, SCOPe 2.08