Lineage for d4exlc_ (4exl C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1391676Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1391677Protein automated matches [190039] (57 species)
    not a true protein
  7. 1392035Species Streptococcus pneumoniae [TaxId:637987] [193477] (5 PDB entries)
  8. 1392039Domain d4exlc_: 4exl C: [220902]
    automated match to d4ecfa_
    complexed with cl, mg

Details for d4exlc_

PDB Entry: 4exl (more details), 1.7 Å

PDB Description: Crystal structure of phosphate ABC transporter, periplasmic phosphate-binding protein PstS 1 (PBP1) from Streptococcus pneumoniae Canada MDR_19A
PDB Compounds: (C:) Phosphate-binding protein pstS 1

SCOPe Domain Sequences for d4exlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4exlc_ c.94.1.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}
esitavgstalqplvevaadefgtihvgktvnvqgggsgtglsqvqsgavdignsdvfae
ekdgidasalvdhkvavaglalivnkevdvdnltteqlrqifigevtnwkevggkdlpis
vinraagsgsratfdtvimegqsamqsqeqdsngavksivskspgaisylsltyiddsvk
smklngydlspenissnnwplwsyehmytlgqpnelaaeflnfvlsdetqegivkglkyi
pikemkvekdaagtvtvlegrq

SCOPe Domain Coordinates for d4exlc_:

Click to download the PDB-style file with coordinates for d4exlc_.
(The format of our PDB-style files is described here.)

Timeline for d4exlc_: