Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.134: LmbE-like [102587] (1 superfamily) 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest; topological similarity to SAM-dependent methyltransferases |
Superfamily c.134.1: LmbE-like [102588] (2 families) |
Family c.134.1.1: LmbE-like [102589] (3 proteins) putative deacetylases |
Protein automated matches [227093] (1 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [226479] (1 PDB entry) |
Domain d4ewla_: 4ewl A: [220897] automated match to d1q74a_ complexed with act, gol, pe4, zn |
PDB Entry: 4ewl (more details), 1.85 Å
SCOPe Domain Sequences for d4ewla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ewla_ c.134.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} msetprllfvhahpddeslsngatiahytsrgaqvhvvtctlgeegevigdrwaqltadh adqlggyrigeltaalralgvsapiylggagrwrdsgmagtdqrsqrrfvdadprqtvga lvaiirelrphvvvtydpnggyghpdhvhthtvttaavaaagvgsgtadhpgdpwtvpkf ywtvlglsalisgaralvpddlrpewvlpradeiafgysddgidavveadeqaraakvaa laahatqvvvgptgraaalsnnlalpiladehyvlaggsagardergwetdllaglgft
Timeline for d4ewla_: