Lineage for d4ewjb2 (4ewj B:138-433)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2086989Family c.1.11.1: Enolase [51605] (2 protein domains)
    automatically mapped to Pfam PF00113
  6. 2087073Protein automated matches [226973] (6 species)
    not a true protein
  7. 2087090Species Streptococcus suis [TaxId:1307] [226502] (1 PDB entry)
  8. 2087092Domain d4ewjb2: 4ewj B:138-433 [220896]
    Other proteins in same PDB: d4ewja1, d4ewjb1
    automated match to d1w6ta1

Details for d4ewjb2

PDB Entry: 4ewj (more details), 2.4 Å

PDB Description: structure of the enloase from Streptococcus suis serotype 2
PDB Compounds: (B:) Enolase 2

SCOPe Domain Sequences for d4ewjb2:

Sequence, based on SEQRES records: (download)

>d4ewjb2 c.1.11.1 (B:138-433) automated matches {Streptococcus suis [TaxId: 1307]}
ntkvlptpmmniinggshsdapiafqefmilpvgapsfkeglrwgaevfhalkkilkarg
lvtavgdeggfapkfegtedgvetiieaieaagyeagengimigfdcassefydkerkvy
dytkfegegaavrtsaeqidyleelvnkypiitiedgmdendwdgwkalterlgkrvqlv
gddffvtntdylargikegaansilikvnqigtltetfeaiemakeagytavvshrsget
edstiadiavatnagqiktgslsrtdriakynqllriedqlgevavykglnsfynl

Sequence, based on observed residues (ATOM records): (download)

>d4ewjb2 c.1.11.1 (B:138-433) automated matches {Streptococcus suis [TaxId: 1307]}
ntkvlptpmmniinggshsdapiafqefmilpvgapsfkeglrwgaevfhalkkilkarg
lvtavgdeggfapkfegtedgvetiieaieaagyeagengimigfdcassefydrkvydy
tkfegegaavrtsaeqidyleelvnkypiitiedgmdendwdgwkalterlgkrvqlvgd
dffvtntdylargikegaansilikvnqigtltetfeaiemakeagytavvshrsgeted
stiadiavatnagqiktgslsrtdriakynqllriedqlgevavykglnsfynl

SCOPe Domain Coordinates for d4ewjb2:

Click to download the PDB-style file with coordinates for d4ewjb2.
(The format of our PDB-style files is described here.)

Timeline for d4ewjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ewjb1