![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Burkholderia phymatum [TaxId:391038] [226379] (1 PDB entry) |
![]() | Domain d4ewgb2: 4ewg B:254-408 [220892] Other proteins in same PDB: d4ewga3 automated match to d1ek4a2 complexed with ca, edo, imd |
PDB Entry: 4ewg (more details), 2.25 Å
SCOPe Domain Sequences for d4ewgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ewgb2 c.95.1.0 (B:254-408) automated matches {Burkholderia phymatum [TaxId: 391038]} haeivgfgcnsdgahmtqptastmaramqlaledakldanaiayvnahgtstdrgdvaes qatartfgermpisslksyvghtlgacgaleawwtiemmkrnwyaptlnltevdpacapl dyirgearaidaeyvmsnnfafggintslifrrvr
Timeline for d4ewgb2: