Lineage for d4ewgb2 (4ewg B:254-408)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917486Species Burkholderia phymatum [TaxId:391038] [226379] (1 PDB entry)
  8. 2917490Domain d4ewgb2: 4ewg B:254-408 [220892]
    Other proteins in same PDB: d4ewga3
    automated match to d1ek4a2
    complexed with ca, edo, imd

Details for d4ewgb2

PDB Entry: 4ewg (more details), 2.25 Å

PDB Description: crystal structure of a beta-ketoacyl synthase from burkholderia phymatum stm815
PDB Compounds: (B:) Beta-ketoacyl synthase

SCOPe Domain Sequences for d4ewgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ewgb2 c.95.1.0 (B:254-408) automated matches {Burkholderia phymatum [TaxId: 391038]}
haeivgfgcnsdgahmtqptastmaramqlaledakldanaiayvnahgtstdrgdvaes
qatartfgermpisslksyvghtlgacgaleawwtiemmkrnwyaptlnltevdpacapl
dyirgearaidaeyvmsnnfafggintslifrrvr

SCOPe Domain Coordinates for d4ewgb2:

Click to download the PDB-style file with coordinates for d4ewgb2.
(The format of our PDB-style files is described here.)

Timeline for d4ewgb2: