Lineage for d4ewgb1 (4ewg B:1-253)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2524747Species Burkholderia phymatum [TaxId:391038] [226379] (1 PDB entry)
  8. 2524750Domain d4ewgb1: 4ewg B:1-253 [220891]
    Other proteins in same PDB: d4ewga3
    automated match to d2bywa1
    complexed with ca, edo, imd

Details for d4ewgb1

PDB Entry: 4ewg (more details), 2.25 Å

PDB Description: crystal structure of a beta-ketoacyl synthase from burkholderia phymatum stm815
PDB Compounds: (B:) Beta-ketoacyl synthase

SCOPe Domain Sequences for d4ewgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ewgb1 c.95.1.0 (B:1-253) automated matches {Burkholderia phymatum [TaxId: 391038]}
mkrvvitgmggvtalgsrwdeieaalkagrnavrrmpdwdyfeslhtrlaaplpgfaqpa
dwprkktrsmgrvsmyavraselaladagfagdesisdgrmgvaygsssgsvepirafgt
mlesgsmtdvtsnsyvqmmphttavnvslfwdlkgrivptssacasgsqaigyayeniam
gkqtlmlaggaeelsgpavavfdtlyatstrndephltprpfdakrdglvvgegaatlvl
eeyehakargati

SCOPe Domain Coordinates for d4ewgb1:

Click to download the PDB-style file with coordinates for d4ewgb1.
(The format of our PDB-style files is described here.)

Timeline for d4ewgb1: