SCOPe 2.07: Domain d4ewga2: 4ewg A:254-408

Lineage for d4ewga2 (4ewg A:254-408)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Burkholderia phymatum [TaxId:391038] [226379] (1 PDB entry)

8. Domain d4ewga2: 4ewg A:254-408 [220890]
   Other proteins in same PDB: d4ewga3
   automated match to d1ek4a2
   complexed with ca, edo, imd

Details for d4ewga2

PDB Entry: 4ewg, 2.25 Å

PDB Description: crystal structure of a beta-ketoacyl synthase from burkholderia phymatum stm815

PDB Compounds: (A:) Beta-ketoacyl synthase

SCOPe Domain Sequences for d4ewga2:

Sequence; same for both SEQRES and ATOM records:

>d4ewga2 c.95.1.0 (A:254-408) automated matches {Burkholderia phymatum [TaxId: 391038]}
haeivgfgcnsdgahmtqptastmaramqlaledakldanaiayvnahgtstdrgdvaes
qatartfgermpisslksyvghtlgacgaleawwtiemmkrnwyaptlnltevdpacapl
dyirgearaidaeyvmsnnfafggintslifrrvr

Timeline for d4ewga2:

• d4ewga2 first appeared in SCOPe 2.03
  
• d4ewga2 appears in SCOPe 2.06
  
• d4ewga2 appears in the current release, SCOPe 2.08